Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1457 (MJ1457)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1457 (MJ1457) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1457

UniProt

Q58852

Expression Region

1-135

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMVMTALTLLILFFGLAFILVGFGLILGYLIFSRKNKTVNGTANRTVVVERDSSNLLGTA AAVAGGVIAGELITDAIEDVINNNENNEADGYNSEGIETTIEDTIEEIDKGVDNVIEDIT DEIDNITNDIGDSFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Endophilin-A2 (SH3GL1) ELISA Kit
AE19691BO-01 48 Tests

Bovine Endophilin-A2 (SH3GL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Endophilin-A2 (SH3GL1) ELISA Kit
AE19691BO-02 96 Tests

Bovine Endophilin-A2 (SH3GL1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Senataxin Antibody [Alexa Fluor 594]
NB100-57542AF594 100 µL

Rabbit Polyclonal Senataxin Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
RHEBL1 Protein Vector (Mouse) (pPM-C-HA)
PV223996 500 ng

RHEBL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GAD67 Recombinant Rabbit mAb
E43S45654 100 µL

GAD67 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ITGA7 Polyclonal Antibody, Biotin Conjugated
bs-23229R-Biotin 100 µL

ITGA7 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details