Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Cytochrome b5 type B (CYB5B)

This Recombinant Pongo abelii Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

Q5RDJ5

Expression Region

12-146

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTPESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sox30 Mouse Gene Knockout Kit (CRISPR)
KN516498 1 Kit

Sox30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody
TA369005 100 µL

Non Neuronal Enolase (ENO1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Melengestrol Acetate
TRC-M215350-25MG 25 mg

Melengestrol Acetate

Sign In for Pricing
View Details
Rabeprazole Sulfide N-Oxide
TRC-R070535-25MG 25 mg

Rabeprazole Sulfide N-Oxide

Sign In for Pricing
View Details
Human FRG2 activation kit by CRISPRa
GA118563 1 Kit

Human FRG2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF647 conjugate, 0.1mg/mL
BNC471789-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (rIG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details