Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Cytochrome b5 type B (CYB5B)

This Recombinant Pongo abelii Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

Q5RDJ5

Expression Region

12-146

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTPESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP40 Human Gene Knockout Kit (CRISPR)
KN419319 1 Kit

RPP40 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc1a3 Mouse Gene Knockout Kit (CRISPR)
KN515914 1 Kit

Slc1a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-2-Butene-1,4-diol
TRC-B754450-1G 1 g

trans-2-Butene-1,4-diol

Sign In for Pricing
View Details
MVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1D7]
TA502934AM 100 µL

MVK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1D7]

Sign In for Pricing
View Details
VC Lambda / BssT1I Marker (ready-to-use), 5 x 50µg
NM2436 5 x 50μg

VC Lambda / BssT1I Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
Iftap Mouse Gene Knockout Kit (CRISPR)
KN501905 1 Kit

Iftap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details