Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Cytochrome b5 type B (CYB5B)

This Recombinant Pongo abelii Cytochrome b5 type B (CYB5B) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

Q5RDJ5

Expression Region

12-146

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTPESKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromo 2,3,4-Tri-O-acetyl-Alpha-D-xylopyranoside (Stabilized with 2.5% CaCO3)
TRC-B688345-50MG 50 mg

Bromo 2,3,4-Tri-O-acetyl-Alpha-D-xylopyranoside (Stabilized with 2.5% CaCO3)

Sign In for Pricing
View Details
Erlose
TRC-E615640-2.5MG 2.5 mg

Erlose

Sign In for Pricing
View Details
ABCD2 (C-term) Rabbit Polyclonal Antibody
AP50019PU-N 400 µL

ABCD2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM10 (NM_052828) Human Recombinant Protein
TP310882M 100 µg

TRIM10 (NM_052828) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CBX5 Antibody
RC-4749-01 50 μL

Recombinant CBX5 Antibody

Sign In for Pricing
View Details
Recombinant CBX5 Antibody
RC-4749-02 100 µL

Recombinant CBX5 Antibody

Sign In for Pricing
View Details