Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0299 membrane protein YPTB1529 (YPTB1529)

This Recombinant UPF0299 membrane protein YPTB1529 (YPTB1529) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

UPF0299 membrane protein YPTB1529

UniProt

Q66C77

Expression Region

1-135

Origin

Yersinia pseudotuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL
BNC880965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details