Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b5 type B (Cyb5b)

This Recombinant Mouse Cytochrome b5 type B (Cyb5b) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

Q9CQX2

Expression Region

12-146

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAIL IGFLYRHFWADSKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Galectin-3 Antibody (M3/38) [DyLight 680]
NBP1-43313FR 0.1 mL

Rat Monoclonal Galectin-3 Antibody (M3/38) [DyLight 680]

Sign In for Pricing
View Details
hsa-miR-3605-3p miRNA Antagomir
MBS8317034-01 10 nmol

hsa-miR-3605-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3605-3p miRNA Antagomir
MBS8317034-02 20 nmol

hsa-miR-3605-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3605-3p miRNA Antagomir
MBS8317034-03 5x 20 nmol

hsa-miR-3605-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-1292-5p miRNA Antagomir
abx886062-01 10 nmol

Human hsa-miR-1292-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-1292-5p miRNA Antagomir
abx886062-02 20 nmol

Human hsa-miR-1292-5p miRNA Antagomir

Sign In for Pricing
View Details