Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b5 type B (Cyb5b)

This Recombinant Mouse Cytochrome b5 type B (Cyb5b) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

Q9CQX2

Expression Region

12-146

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAIL IGFLYRHFWADSKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasal2 Mouse shRNA Plasmid (Locus ID 226525)
TR519797 1 Kit

Rasal2 Mouse shRNA Plasmid (Locus ID 226525)

Sign In for Pricing
View Details
1700037C18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10228094 4x 500 ng

1700037C18Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Anti-Human Centromere protein T Antibody, APC Conjugate
DZ41607-APC 200 µL/Vial

Anti-Human Centromere protein T Antibody, APC Conjugate

Sign In for Pricing
View Details
GlcD Antibody
PHY5372S 150 μg

GlcD Antibody

Sign In for Pricing
View Details
RPS3AP22 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV782038 1.0 µg DNA

RPS3AP22 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
anti-DNAJB6
YF-PA16676 100 ul

anti-DNAJB6

Sign In for Pricing
View Details