Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 type B (Cyb5b)

This Recombinant Rat Cytochrome b5 type B (Cyb5b) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

P04166

Expression Region

12-146

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAIL IGFLYRHFWADSKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hpd activation kit by CRISPRa
GA201978 1 Kit

Mouse Hpd activation kit by CRISPRa

Sign In for Pricing
View Details
RALY Antibody
OC-221-01 50 μL

RALY Antibody

Sign In for Pricing
View Details
RALY Antibody
OC-221-02 100 µL

RALY Antibody

Sign In for Pricing
View Details
RALY Antibody
OC-221-03 1 mL

RALY Antibody

Sign In for Pricing
View Details
TRIM54 Antibody
KC-2711-01 50 μL

TRIM54 Antibody

Sign In for Pricing
View Details
TRIM54 Antibody
KC-2711-02 100 µL

TRIM54 Antibody

Sign In for Pricing
View Details