Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 type B (Cyb5b)

This Recombinant Rat Cytochrome b5 type B (Cyb5b) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

P04166

Expression Region

12-146

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAIL IGFLYRHFWADSKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTLA4 (NM_001037631) Human Over-expression Lysate
LC421970 20 µg

CTLA4 (NM_001037631) Human Over-expression Lysate

Sign In for Pricing
View Details
Bromodeoxyuridine / BrDU Mouse Monoclonal Antibody [Clone ID: BRD469]
AM32817PU-T 20 µg

Bromodeoxyuridine / BrDU Mouse Monoclonal Antibody [Clone ID: BRD469]

Sign In for Pricing
View Details
USP4 (N-term) Rabbit Polyclonal Antibody
AP54490PU-N 400 µL

USP4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tigit Mouse Gene Knockout Kit (CRISPR)
KN317567 1 Kit

Tigit Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Peripherin Recombinant Chimeric Antibody Antibody
HA601405 100 µL

Peripherin Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559132 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details