Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 type B (Cyb5b)

This Recombinant Rat Cytochrome b5 type B (Cyb5b) spans the amino acid sequence from region 12-146.

Product Specifications

Product Name Alternative

Cytochrome b5 type B, Cytochrome b5 outer mitochondrial membrane isoform

UniProt

P04166

Expression Region

12-146

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADAT ESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAIL IGFLYRHFWADSKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scarb2 Mouse Gene Knockout Kit (CRISPR)
KN515344 1 Kit

Scarb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat Cathepsin B/CTSB Protein (His Tag)
PKSR030155 50 µg

Recombinant Rat Cathepsin B/CTSB Protein (His Tag)

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF740 conjugate, 0.1mg/mL
BNC740418-100 1x 100 µL

Fascin-1 (FSCN1/418), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Peroxiredoxin 4 (PRDX4) Human Gene Knockout Kit (CRISPR)
KN203330RB 1 Kit

Peroxiredoxin 4 (PRDX4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NIPSNAP3A (Center) Rabbit Polyclonal Antibody
AP52921PU-N 400 µL

NIPSNAP3A (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details