Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome b5

This Recombinant Cuscuta reflexa Cytochrome b5 spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P49097

Expression Region

1-135

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGSKVYSLAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFED IGHSSSARAMMDEMCVGDIDSSTIPTKTSYTPPKQPLYNQDKTPQFIIKLLQFLVPLIIL GVAVGIRFYKKQSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARF1 shRNA (UAS) - Lentiviral human ARF1 shRNA (UAS) plasmid
GTR15114631 1 Vial

Lentiviral human ARF1 shRNA (UAS) - Lentiviral human ARF1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MEGF11 Protein Vector (Human) (pPB-N-His)
PV093767 500 ng

MEGF11 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
1-[4- (Difluoromethoxy) phenyl]propan-1-amine
FFA33951-01 50 mg

1-[4- (Difluoromethoxy) phenyl]propan-1-amine

Sign In for Pricing
View Details
1-[4- (Difluoromethoxy) phenyl]propan-1-amine
FFA33951-02 0.5 g

1-[4- (Difluoromethoxy) phenyl]propan-1-amine

Sign In for Pricing
View Details
Abhd11 Antibody, Biotin conjugated
CSB-PA811717LD01MO-01 50 µg

Abhd11 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Abhd11 Antibody, Biotin conjugated
CSB-PA811717LD01MO-02 100 µg

Abhd11 Antibody, Biotin conjugated

Sign In for Pricing
View Details