Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Large-conductance mechanosensitive channel (mscL)

This Recombinant Citrobacter koseri Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A8AQI5

Expression Region

1-136

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINKLNRKKEEPTEAPAPTTEEV LLSEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-500 1x 500 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF405S conjugate, 0.1mg/mL
BNC041152-100 1x 100 µL

IDH1 (IDH1/1152), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL
BNC941917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL
BNCB1429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details