Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia fergusonii Large-conductance mechanosensitive channel (mscL)

This Recombinant Escherichia fergusonii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7LRQ7

Expression Region

1-136

Origin

Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF568 conjugate, 0.1mg/mL
BNC682200-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF594 conjugate, 0.1mg/mL
BNC941104-500 1x 500 µL

PAX2 (Renal Cell & Ovarian Carcinoma Marker) (PAX2/1104), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF740 conjugate, 0.1mg/mL
BNC741887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL
BNC880416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details