Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 78 (TMEM78)

This Recombinant Human Transmembrane protein 78 (TMEM78) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Transmembrane protein 78

UniProt

Q5T7P6

Expression Region

1-136

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLDTRNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRREFLLPACLPAFLS FSTSFSFFLSFLPLSLSLFLPFFPSFFLSLSLSPSFLPSFLRQGLALSPRLECDGAIMIH CSLNIPGSSDPPTSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxb13 Antibody - N-terminal region
ARP36889_P050-25UL 25 µL

Hoxb13 Antibody - N-terminal region

Sign In for Pricing
View Details
CD159a Blocking Peptide
CBP4707-01 1 mg

CD159a Blocking Peptide

Sign In for Pricing
View Details
CD159a Blocking Peptide
CBP4707-02 5 mg

CD159a Blocking Peptide

Sign In for Pricing
View Details
anti-Complement factor C9 (64E9)
LF-MA0168 100 ul

anti-Complement factor C9 (64E9)

Sign In for Pricing
View Details
Rat Glutathione S Transferase Pi (GSTp) ELISA Kit
201-11-1691 96 Tests

Rat Glutathione S Transferase Pi (GSTp) ELISA Kit

Sign In for Pricing
View Details
H2AZ rabbit pAb
ES11741-01 50 µL

H2AZ rabbit pAb

Sign In for Pricing
View Details