Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 78 (TMEM78)

This Recombinant Human Transmembrane protein 78 (TMEM78) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Transmembrane protein 78

UniProt

Q5T7P6

Expression Region

1-136

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLDTRNLGIVISCWKGVCVPQTTTLEMFYNDNDRVEESSNSYQIRREFLLPACLPAFLS FSTSFSFFLSFLPLSLSLFLPFFPSFFLSLSLSPSFLPSFLRQGLALSPRLECDGAIMIH CSLNIPGSSDPPTSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX15 siRNA (Human)
orb1858997-01 15 nmol

SNX15 siRNA (Human)

Sign In for Pricing
View Details
SNX15 siRNA (Human)
orb1858997-02 30 nmol

SNX15 siRNA (Human)

Sign In for Pricing
View Details
GPR165P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV762409 1.0 µg DNA

GPR165P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
BEND3 Antibody - C-terminal region
OAAB12029-400UL 400 µL

BEND3 Antibody - C-terminal region

Sign In for Pricing
View Details
ARF6 Rabbit mAb
E45R12598N 50 ul

ARF6 Rabbit mAb

Sign In for Pricing
View Details
1600012F09Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10100114 3x 1.0 µg

1600012F09Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details