Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynfC (ynfC)

This Recombinant Bacillus subtilis Uncharacterized protein ynfC (ynfC) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Uncharacterized protein ynfC

UniProt

Q45067

Expression Region

1-136

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWGIIIKIFSNIKGGGDHLKKVTILKASILFLAIASFHLFSIPHAFDIGHHYKAVADQQ EMHEMKAGQNADDEKKSITGAFTLTALWAMAVLLLTAESKSTGYSRRRQRKKSFILAKFY QSSYFGKLHVQHHPIM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glass Bottle 40 x 300mm (diameter x length)
CSL-NHYBBT40X300 1 Each

Glass Bottle 40 x 300mm (diameter x length)

Sign In for Pricing
View Details
Mouse Irak3 Pre-designed siRNA Set B
SI106806B 1 Each

Mouse Irak3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
COPS3 Antibody - C-terminal region : Biotin (ARP59347_P050-Biotin)
ARP59347_P050-Biotin 100 µL

COPS3 Antibody - C-terminal region : Biotin (ARP59347_P050-Biotin)

Sign In for Pricing
View Details
XK Blocking Peptide
MBS9633348-01 1 mg

XK Blocking Peptide

Sign In for Pricing
View Details
XK Blocking Peptide
MBS9633348-02 5x 1 mg

XK Blocking Peptide

Sign In for Pricing
View Details
VP16 (1-21) AC
sc-7545 AC 500 µg/mL - 25% ag

VP16 (1-21) AC

Sign In for Pricing
View Details