Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein in hblA 3'region

This Recombinant Uncharacterized protein in hblA 3'region spans the amino acid sequence from region 23-158.

Product Specifications

Product Name Alternative

Uncharacterized protein in hblA 3'region

UniProt

Q45104

Expression Region

23-158

Origin

Bacillus cereus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIPIETFAIEIQQTNTENRSLSANEEQMKKALQDAGLFVKAMNEYSYLLIHNPDVSFEGI TINGNTDLPSKIVQDQKNARAHAVTWNTHVKKQLLDTLTGIIEYDTKFENHYETLVEAIN TGNGDTLKKGITDLQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783E-01 25 µg

APC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
APC Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783E-02 100 µg

APC Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Sambucus nigra -SNA-I- Immobilized Lectin
AK-6802-1 1 mL/Kit

Sambucus nigra -SNA-I- Immobilized Lectin

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS708118 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
TBXAS1 (Center) Rabbit Polyclonal Antibody
AP51174PU-N 400 µL

TBXAS1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF594 conjugate, 0.1mg/mL
BNC942059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details