Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Keratinocyte-associated protein 2 (Krtcap2)

This Recombinant Mouse Keratinocyte-associated protein 2 (Krtcap2) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 2, KCP-2

UniProt

Q5RL79

Expression Region

1-136

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PVLTPAKITGKGKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V (D) J recombination-activating protein 2
AP86898 1 mg

V (D) J recombination-activating protein 2

Sign In for Pricing
View Details
TCN2 Protein Lysate
OCOA21089-20UG 20 µg

TCN2 Protein Lysate

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-01 48 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-02 96 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-03 5x 96 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit
MBS7202179-04 10x 96 Well

Rabbit Olfactory receptor 2M4 (OR2M4) ELISA Kit

Sign In for Pricing
View Details