Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2)

This Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 2, KCP-2

UniProt

P86229

Expression Region

1-136

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAT PVLTPAKVTGKGKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PotD Antibody
orb824183 2 mg

PotD Antibody

Sign In for Pricing
View Details
Occludin (OCLN) (NM_002538) Human Over-expression Lysate
LS100506658-20ug 20 µg

Occludin (OCLN) (NM_002538) Human Over-expression Lysate

Sign In for Pricing
View Details
THT-7-413-3 Pre-sized Labels for Printers
104176 3000 Roll (3000 Label (s) x 1 Roll)

THT-7-413-3 Pre-sized Labels for Printers

Sign In for Pricing
View Details
SNX24, ID (SNX24, Sorting nexin-24) (PE) discontinued
042116-PE 200 µL

SNX24, ID (SNX24, Sorting nexin-24) (PE) discontinued

Sign In for Pricing
View Details
hsa-miR-146a-5p miRNA Inhibitor
MIH01328 2x 5.0 nmol

hsa-miR-146a-5p miRNA Inhibitor

Sign In for Pricing
View Details
Krtap20-2-set siRNA/shRNA/RNAi Lentivector (Mouse)
26159094 4x 500 ng

Krtap20-2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details