Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2)

This Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 2, KCP-2

UniProt

P86229

Expression Region

1-136

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAT PVLTPAKVTGKGKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA12A
E8ER1910-91 100 µL

HSPA12A

Sign In for Pricing
View Details
KLRA1 Antibody
orb75134 100 µL

KLRA1 Antibody

Sign In for Pricing
View Details
NC190 sodium
MBS5775589 Inquire

NC190 sodium

Sign In for Pricing
View Details
NUP210P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV772097 1.0 µg DNA

NUP210P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Curcumin o-glucuronide-d6
CS-O-60665 1 Each

Curcumin o-glucuronide-d6

Sign In for Pricing
View Details
ENOPH1 Rabbit Polyclonal Antibody (HRP)
orb2101496 100 µL

ENOPH1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details