Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2)

This Recombinant Dog Keratinocyte-associated protein 2 (KRTCAP2) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 2, KCP-2

UniProt

P86229

Expression Region

1-136

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAT PVLTPAKVTGKGKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

At1g49610 Antibody
orb788535 2 mg

At1g49610 Antibody

Sign In for Pricing
View Details
DPCR1 (Center) Rabbit pAb
MBS8553521-01 0.1 mL

DPCR1 (Center) Rabbit pAb

Sign In for Pricing
View Details
DPCR1 (Center) Rabbit pAb
MBS8553521-02 0.1 mL (AF405L)

DPCR1 (Center) Rabbit pAb

Sign In for Pricing
View Details
DPCR1 (Center) Rabbit pAb
MBS8553521-03 0.1 mL (AF405S)

DPCR1 (Center) Rabbit pAb

Sign In for Pricing
View Details
DPCR1 (Center) Rabbit pAb
MBS8553521-04 0.1 mL (AF610)

DPCR1 (Center) Rabbit pAb

Sign In for Pricing
View Details
DPCR1 (Center) Rabbit pAb
MBS8553521-05 0.1 mL (AF635)

DPCR1 (Center) Rabbit pAb

Sign In for Pricing
View Details