Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Keratinocyte-associated protein 2 (Krtcap2)

This Recombinant Rat Keratinocyte-associated protein 2 (Krtcap2) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

Keratinocyte-associated protein 2, KCP-2

UniProt

B2RZC9

Expression Region

1-136

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVGTGTSLALSSLLSLLLFAGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PALTPAKVTGKSKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Teclistamab Biosimilar - Research Grade
ICH5209-10mg 10 mg (2x 5 mg)

Teclistamab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rat Coagulation Factor V (F5) ELISA Kit
EKN44375 96 Tests

Rat Coagulation Factor V (F5) ELISA Kit

Sign In for Pricing
View Details
B-Cell Lymphoma/Leukemia 11A (BCL11A) Antibody
abx457079-01 50 µg

B-Cell Lymphoma/Leukemia 11A (BCL11A) Antibody

Sign In for Pricing
View Details
B-Cell Lymphoma/Leukemia 11A (BCL11A) Antibody
abx457079-02 100 µg

B-Cell Lymphoma/Leukemia 11A (BCL11A) Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
TRV-0050166-01 20 µL

Polyclonal Antibody to Ciliary Neurotrophic Factor (CNTF)

Sign In for Pricing
View Details
Polyclonal Antibody to Ciliary Neurotrophic Factor (CNTF)
TRV-0050166-02 100 µL

Polyclonal Antibody to Ciliary Neurotrophic Factor (CNTF)

Sign In for Pricing
View Details