Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

P0A1X9

Expression Region

1-137

Origin

Salmonella typhi

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin Recombinant Mouse monoclonal Antibody
IRS229MS 50 Tests

E-Cadherin Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
MAGED1 Polyclonal Antibody
E-AB-10444-01 20 µL

MAGED1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGED1 Polyclonal Antibody
E-AB-10444-02 60 µL

MAGED1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGED1 Polyclonal Antibody
E-AB-10444-03 120 µL

MAGED1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGED1 Polyclonal Antibody
E-AB-10444-04 200 µL

MAGED1 Polyclonal Antibody

Sign In for Pricing
View Details
Sinapine Chloride
TRC-S486805-50MG 50 mg

Sinapine Chloride

Sign In for Pricing
View Details