Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

P0A1X9

Expression Region

1-137

Origin

Salmonella typhi

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TTF1 antibody
STJ11100556 50 µl

Anti-TTF1 antibody

Sign In for Pricing
View Details
CTAG1B Peptide - C-terminal region (AAP60762)
AAP60762-100UG 100 µg

CTAG1B Peptide - C-terminal region (AAP60762)

Sign In for Pricing
View Details
Vom1r90 Protein Vector (Rat) (pPB-C-His)
PV315638 500 ng

Vom1r90 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)
orb2990582-01 100 µL

Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)
orb2990582-02 500 µL

Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)
orb2990582-03 1 mL

Rabbit Anti-Bovine IgG (H&L) Antibody (AcalephFluor405)

Sign In for Pricing
View Details