Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

P0A1X9

Expression Region

1-137

Origin

Salmonella typhi

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (AP) discontinued
H6098-68B-AP 200 µL

HLA Class 1 Antigen E (HLA Class I Histocompatibility Antigen alpha Chain E, HLAE, HLA-E, HLA-6.2, EA1.2, EA2.1, Major Histocompatibility Complex Class I E, MHC Class I Antigen E, QA1) (AP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal IL-5R alpha/CD125 Antibody (1036601) [DyLight 405]
FAB2531E 0.1 mL

Mouse Monoclonal IL-5R alpha/CD125 Antibody (1036601) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Bovine Prefoldin subunit 3 (VBP1)
MBS1467387-01 0.02 mg (E-Coli)

Recombinant Bovine Prefoldin subunit 3 (VBP1)

Sign In for Pricing
View Details
Recombinant Bovine Prefoldin subunit 3 (VBP1)
MBS1467387-02 0.1 mg (E-Coli)

Recombinant Bovine Prefoldin subunit 3 (VBP1)

Sign In for Pricing
View Details
Recombinant Bovine Prefoldin subunit 3 (VBP1)
MBS1467387-03 0.02 mg (Yeast)

Recombinant Bovine Prefoldin subunit 3 (VBP1)

Sign In for Pricing
View Details
Recombinant Bovine Prefoldin subunit 3 (VBP1)
MBS1467387-04 0.1 mg (Yeast)

Recombinant Bovine Prefoldin subunit 3 (VBP1)

Sign In for Pricing
View Details