Recombinant Danio rerio Neurexin-3a-beta (nrxn3a)
This Recombinant Danio rerio Neurexin-3a-beta (nrxn3a) spans the amino acid sequence from region 536-672.
Product Specifications
Product Name Alternative
Neurexin-3a-beta, Neurexin IIIb-beta, Cleaved into the following 2 chains:, 1. Neurexin-3a-beta, soluble form, 2. Neurexin-3a-beta, C-terminal fragment, 3. NRXN3-CTF
UniProt
A1XQY0
Expression Region
536-672
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
KPQPDIVLLPLPTSYEVDNTKMKSPLITSPMFRNVPTAIPTEPGIRRVPGASEVVRESSS TTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYITNSAQSNGAVMKDKQQS TKSGNKKQKNKDKEYYV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741864-500 1x 500 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682341-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details