Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Enterobacter sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A4WF99

Expression Region

1-137

Origin

Enterobacter sp. (strain 638)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIVKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNRKKEEPAAVPPAPSKEE VLLTQIRDLLKEQNNRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 Antibody
KC-2838-01 50 μL

CD34 Antibody

Sign In for Pricing
View Details
CD34 Antibody
KC-2838-02 100 µL

CD34 Antibody

Sign In for Pricing
View Details
CD34 Antibody
KC-2838-03 1 mL

CD34 Antibody

Sign In for Pricing
View Details
Os11g0569800 protein Rabbit Polyclonal Antibody
HA500434 100 µL

Os11g0569800 protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FKBP10 Rabbit Polyclonal Antibody
TA362028 100 µL

FKBP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bulk Anti-Human HLA-A2,B7 (BB7.6) Antibody
ICH1022-100mg 100 mg

Bulk Anti-Human HLA-A2,B7 (BB7.6) Antibody

Sign In for Pricing
View Details