Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL)

This Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A7FNK6

Expression Region

1-137

Origin

Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Minretumomab Biosimilar - Research Grade
ICH5190-20mg 20 mg

Minretumomab Biosimilar - Research Grade

Sign In for Pricing
View Details
BMX Mouse Monoclonal Antibody [Clone ID: 1C6]
AM06441SU-N 100 µL

BMX Mouse Monoclonal Antibody [Clone ID: 1C6]

Sign In for Pricing
View Details
STAT3 Rabbit Polyclonal Antibody
AP01233PU-N 100 µg

STAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ak1 Mouse Gene Knockout Kit (CRISPR)
KN501053 1 Kit

Ak1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Oncostatin M (OSM) (NM_020530) Human Recombinant Protein
TP750016 20 µg

Oncostatin M (OSM) (NM_020530) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS623793 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details