Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

This Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 43, mitochondrial (AIM43) spans the amino acid sequence from region 46-182.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 43, mitochondrial, Found in mitochondrial proteome protein 14

UniProt

C7GJ54

Expression Region

46-182

Origin

Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IKSLEDLANLDSLDGVDTELIRDLINEHTTKLNIKKELDMLKKFSQEEESGHEIPVKRFI RPLWMFILMGSSVYLLLHFSWWKLEHEERESQLKKEVEILEHQLNELIVQDKTHNTSRGK GSNESTHMKPWYRRWFW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL
BNC471784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL
BNC041711-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details