Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA)

This Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit A (nuoA) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit A, EC= 1.6.99.5, NADH dehydrogenase I subunit A, NDH-1 subunit A, NUO1

UniProt

B1J6N4

Expression Region

1-137

Origin

Pseudomonas putida (strain W619)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDSAGLIAHNWGFAIFLLGVVGLCAFMLGLSSLLGSKAWGRAKNEPFESGMLPVGSARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLWRVGA LDWAPEGRRKRQAKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF568 conjugate, 0.1mg/mL
BNC680007-100 1x 100 µL

Cyclin D1 (DCS-6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF640R conjugate, 0.1mg/mL
BNC402386-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF740 conjugate, 0.1mg/mL
BNC742875-100 1x 100 µL

CD44 / HCAM Std. (HCAM/2875R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details