Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas entomophila Large-conductance mechanosensitive channel (mscL)

This Recombinant Pseudomonas entomophila Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q1I4K7

Expression Region

1-137

Origin

Pseudomonas entomophila (strain L48)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGDVPAVVLAYGKFIQTILDFIIVAFAIFMGVKVINRLKREEAVAPTAPPVPSAEE TLLTEIRDLLKAQNRQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-100 1x 100 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), Biotin conjugate, 0.1mg/mL
BNCB0257-500 1x 500 µL

Cytokeratin, HMW (AE-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL
BNC470803-100 1x 100 µL

Cytokeratin 8 (KRT8/803), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details