Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Large-conductance mechanosensitive channel (mscL)

This Recombinant Pseudomonas fluorescens Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q3K6I0

Expression Region

1-137

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGSAPAVVLAYGKFIQSVLDFVIVAFAIFMGVKAINRLKREEAVAPTLPPVPTKEE ELLGEIRDLLKAQNNRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF568 conjugate, 0.1mg/mL
BNC682387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), CF647 conjugate, 0.1mg/mL
BNC471748-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/1748), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL
BNC680746-100 1x 100 µL

CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details