Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q664V0

Expression Region

1-137

Origin

Yersinia pseudotuberculosis

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: sigmoid
CB503313 1 Block

Frozen Tissue Blocks, Colon: sigmoid

Sign In for Pricing
View Details
Frozen Tissue Sections, Tendon
CS638713 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details
Tenm4 Mouse Gene Knockout Kit (CRISPR)
KN517409 1 Kit

Tenm4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-01 50 μL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-02 100 µL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-03 1 mL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details