Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q664V0

Expression Region

1-137

Origin

Yersinia pseudotuberculosis

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMRP (FMR1) (NM_001185075) Human Over-expression Lysate
LC434306 20 µg

FMRP (FMR1) (NM_001185075) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HDHD5 activation kit by CRISPRa
GA109151 1 Kit

Human HDHD5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NSE2 (NSMCE2) activation kit by CRISPRa
GA117272 1 Kit

Human NSE2 (NSMCE2) activation kit by CRISPRa

Sign In for Pricing
View Details
AGER antibody
FNab09951 100 µg

AGER antibody

Sign In for Pricing
View Details
Stanniocalcin 2 (STC2) (NM_003714) Human Over-expression Lysate
LC401224 20 µg

Stanniocalcin 2 (STC2) (NM_003714) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMF1 (NM_006814) Human Over-expression Lysate
LY402038 100 µg

PSMF1 (NM_006814) Human Over-expression Lysate

Sign In for Pricing
View Details