Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q664V0

Expression Region

1-137

Origin

Yersinia pseudotuberculosis

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS800904 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA610342 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human ZBTB11 activation kit by CRISPRa
GA109011 1 Kit

Human ZBTB11 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS651519 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
NADH Oxidase (NOX) Activity Assay Kit
E-BC-K806-M-01 48 T (46 samples)

NADH Oxidase (NOX) Activity Assay Kit

Sign In for Pricing
View Details
NADH Oxidase (NOX) Activity Assay Kit
E-BC-K806-M-02 96 T (94 samples)

NADH Oxidase (NOX) Activity Assay Kit

Sign In for Pricing
View Details