Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Large-conductance mechanosensitive channel (mscL)

This Recombinant Bartonella henselae Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q6G4F8

Expression Region

1-137

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFKEFALKGNMIDLAIGVIIGGAFGGLVNSIVNDIFMPIIGLITGGIDFSNMFIQLA GEKQATLSAAKAAGATISYGNFITLLINFLIIAWVLFLFVKSMNKIRRKQEEEETSKKMS LEQQLLSEIRDLLAKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-100 1x 100 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL
BNC940470-100 1x 100 µL

CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF647 conjugate, 0.1mg/mL
BNC471788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF680 conjugate, 0.1mg/mL
BNC800940-500 1x 500 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details