Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phosphoinositide-interacting protein (PIRT)

This Recombinant Human Phosphoinositide-interacting protein (PIRT) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Phosphoinositide-interacting protein

UniProt

P0C851

Expression Region

1-137

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKH RQKSNFLRSLKSFFLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanine 5 Tyramide
HY-136247-01 1 mg

Cyanine 5 Tyramide

Sign In for Pricing
View Details
Cyanine 5 Tyramide
HY-136247-02 5 mg

Cyanine 5 Tyramide

Sign In for Pricing
View Details
Cyanine 5 Tyramide
HY-136247-03 10 mg

Cyanine 5 Tyramide

Sign In for Pricing
View Details
THNSL2 peptide
orb382234-01 1 mg

THNSL2 peptide

Sign In for Pricing
View Details
THNSL2 peptide
orb382234-02 5 mg

THNSL2 peptide

Sign In for Pricing
View Details
CXorf52 sgRNA CRISPR Lentivector (Human) (Target 2)
K0539603 1.0 µg DNA

CXorf52 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details