Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042 (UU042)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042 (UU042) spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Uncharacterized protein UU042

UniProt

Q9PRA3

Expression Region

1-138

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPISIELIIQISIGLSASLILLFAFLPQTLLTIKTKNTAALTISMFIICFIARLCFSLS AILTIIVYIHNQNYGLSLYALTLPVLICHGINMLLNLIIAFIKINNVYKAKIHKMNENEY IIFAYAQKLKEKVSIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPX8 Protein Vector (Human) (pPB-N-His)
PV018630 500 ng

GPX8 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Estriol-d3
011398 1 mg

Estriol-d3

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to APBB1IP
MBS8528109-01 0.1 mL

Mouse Monoclonal Antibody to APBB1IP

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to APBB1IP
MBS8528109-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to APBB1IP

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to APBB1IP
MBS8528109-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to APBB1IP

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to APBB1IP
MBS8528109-04 0.1 mL (AF610)

Mouse Monoclonal Antibody to APBB1IP

Sign In for Pricing
View Details