Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042 (UU042)

This Recombinant Ureaplasma parvum serovar 3 Uncharacterized protein UU042 (UU042) spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Uncharacterized protein UU042

UniProt

Q9PRA3

Expression Region

1-138

Origin

Ureaplasma parvum serovar 3 (strain ATCC 700970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPISIELIIQISIGLSASLILLFAFLPQTLLTIKTKNTAALTISMFIICFIARLCFSLS AILTIIVYIHNQNYGLSLYALTLPVLICHGINMLLNLIIAFIKINNVYKAKIHKMNENEY IIFAYAQKLKEKVSIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B 4148
T71571-01 25 mg

B 4148

Sign In for Pricing
View Details
B 4148
T71571-02 50 mg

B 4148

Sign In for Pricing
View Details
B 4148
T71571-03 100 mg

B 4148

Sign In for Pricing
View Details
PTAC1 Antibody
PHY2592A 150 μg

PTAC1 Antibody

Sign In for Pricing
View Details
CD235a Antibody
orb434623 0.2 mg

CD235a Antibody

Sign In for Pricing
View Details
STK32C (NM_173575) Human Over-expression Lysate
LS282974-100ug 100 µg

STK32C (NM_173575) Human Over-expression Lysate

Sign In for Pricing
View Details