Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raphanus sativus Uncharacterized mitochondrial protein ORF138

This Recombinant Raphanus sativus Uncharacterized mitochondrial protein ORF138 spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial protein ORF138

UniProt

P68514

Expression Region

1-138

Origin

Raphanus sativus (Radish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLK IPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGK GEIEGKEEKKEVENGPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS1 Polyclonal Antibody
E-AB-70245-01 60 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-70245-02 120 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS1 Polyclonal Antibody
E-AB-70245-03 200 µL

SOCS1 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF280C Antibody
8C18987-AAT 50 µg

ZNF280C Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS709379 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF740 conjugate, 0.1mg/mL
BNC741010-500 1x 500 µL

Cytochrome C (CYCS/1010), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details