Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Raphanus sativus Uncharacterized mitochondrial protein ORF138

This Recombinant Raphanus sativus Uncharacterized mitochondrial protein ORF138 spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial protein ORF138

UniProt

P68514

Expression Region

1-138

Origin

Raphanus sativus (Radish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLK IPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGK GEIEGKEEKKEVENGPRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat IgG heavy chain Mouse Monoclonal Antibody [B8-C4]
M0910-1 100 µL

Goat IgG heavy chain Mouse Monoclonal Antibody [B8-C4]

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR563046 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein
TP303848M 100 µg

TIM 4 (TIMD4) (NM_138379) Human Recombinant Protein

Sign In for Pricing
View Details
Coproporphyrin III-15N4 Sodium BIsulfate Salt
TRC-C685417-2.5MG 2.5 mg

Coproporphyrin III-15N4 Sodium BIsulfate Salt

Sign In for Pricing
View Details
Anti-IMPG1
Y058757 100 µg

Anti-IMPG1

Sign In for Pricing
View Details
Trpv4 Mouse Gene Knockout Kit (CRISPR)
KN518311 1 Kit

Trpv4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details