Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Janthinobacterium sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6T365

Expression Region

1-139

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMMQEFKEFAVKGNVVDLAVAVIVGAAFGKIVDSLVQDVIMPVVGKIFGGLDFSNYYIA LNNQDPNLTLVEAKKLGAVLAYGNFITIALNFIILAFIIFQMVRLLNKLKRTEPPAPEEP AAVPEDIALLREIRDSLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (acetyl K27) Mouse Monoclonal Antibody [A6D6]
HA600048 100 µL

Histone H3 (acetyl K27) Mouse Monoclonal Antibody [A6D6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS707385 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ALDH1L1 Antibody
KC-29464-01 50 μL

ALDH1L1 Antibody

Sign In for Pricing
View Details
ALDH1L1 Antibody
KC-29464-02 100 µL

ALDH1L1 Antibody

Sign In for Pricing
View Details
ALDH1L1 Antibody
KC-29464-03 1 mL

ALDH1L1 Antibody

Sign In for Pricing
View Details
Diphenyl-2-pyridylphosphine
TRC-D491940-5G 5 g

Diphenyl-2-pyridylphosphine

Sign In for Pricing
View Details