Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Janthinobacterium sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A6T365

Expression Region

1-139

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMMQEFKEFAVKGNVVDLAVAVIVGAAFGKIVDSLVQDVIMPVVGKIFGGLDFSNYYIA LNNQDPNLTLVEAKKLGAVLAYGNFITIALNFIILAFIIFQMVRLLNKLKRTEPPAPEEP AAVPEDIALLREIRDSLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NEFL Antibody Pair Set
E-KAB-0485 50 µL & 100 µg

Human NEFL Antibody Pair Set

Sign In for Pricing
View Details
Human ATP6V1E2 activation kit by CRISPRa
GA114020 1 Kit

Human ATP6V1E2 activation kit by CRISPRa

Sign In for Pricing
View Details
TNF alpha (TNF656), CF405S conjugate, 0.1mg/mL
BNC040656-100 1x 100 µL

TNF alpha (TNF656), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ICA1 Antibody
KC-3021-01 50 μL

ICA1 Antibody

Sign In for Pricing
View Details
ICA1 Antibody
KC-3021-02 100 µL

ICA1 Antibody

Sign In for Pricing
View Details
ICA1 Antibody
KC-3021-03 1 mL

ICA1 Antibody

Sign In for Pricing
View Details