Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein LOC388820

This Recombinant Human Putative uncharacterized protein LOC388820 spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Putative uncharacterized protein LOC388820

UniProt

A8MWV9

Expression Region

1-139

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWAKWTPHEASNQTQASTLLGLLLGDHTEGRNDTNSTRALKVPDGTSAAWYILTIIGIY AVIFVFRLASNILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQA HLGAKGGSSGPQTATPETP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-3620-5p miRNA Mimic
CMM1827-01 5 nmol

Mmu-miR-3620-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-3620-5p miRNA Mimic
CMM1827-02 10 nmol

Mmu-miR-3620-5p miRNA Mimic

Sign In for Pricing
View Details
MTMR1 (h) -PR
sc-61084-PR 10 µM - 20 µL

MTMR1 (h) -PR

Sign In for Pricing
View Details
PAEL Receptor, NT (Probable G-protein Coupled Receptor 37, Endothelin B Receptor-like Protein-1, ETBR-LP-1, Parkin-associated Endothelin Receptor-like Receptor, PAELR, GPR37) (MaxLight 650)
MBS6491732-01 0.1 mL

PAEL Receptor, NT (Probable G-protein Coupled Receptor 37, Endothelin B Receptor-like Protein-1, ETBR-LP-1, Parkin-associated Endothelin Receptor-like Receptor, PAELR, GPR37) (MaxLight 650)

Sign In for Pricing
View Details
PAEL Receptor, NT (Probable G-protein Coupled Receptor 37, Endothelin B Receptor-like Protein-1, ETBR-LP-1, Parkin-associated Endothelin Receptor-like Receptor, PAELR, GPR37) (MaxLight 650)
MBS6491732-02 5x 0.1 mL

PAEL Receptor, NT (Probable G-protein Coupled Receptor 37, Endothelin B Receptor-like Protein-1, ETBR-LP-1, Parkin-associated Endothelin Receptor-like Receptor, PAELR, GPR37) (MaxLight 650)

Sign In for Pricing
View Details
Fmoc-d-orn (aloc) -oh
450570-01 100 mg

Fmoc-d-orn (aloc) -oh

Sign In for Pricing
View Details