Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium radiotolerans Large-conductance mechanosensitive channel (mscL)

This Recombinant Methylobacterium radiotolerans Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B1M0R9

Expression Region

1-139

Origin

Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEEFKKFALRGNVVDLAVGVIIGAAFGAIVNSAVQDIFMPVIGAITGGLDFSNYYIPLS SKVQSGLPYVDAKKQGAVIGYGQFLTLTLNFAIVAFVLFLVIRAMNRLQLAETKKPDEVP ADVKLLSEIRDILATKPRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL
BNC680191-100 1x 100 µL

MyoD1 (5.8A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details