Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 18 (TMEM18)

This Recombinant Bovine Transmembrane protein 18 (TMEM18) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Transmembrane protein 18

UniProt

Q3SZ36

Expression Region

1-139

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSAFSVSRFPVSIPAVITQTDWTEPWLVGLAGFHVLCLLLTCFSSQRYRLQVGHFLCLV TLVYCAEYINEVAAMNWRLFSKHQYFDSRGMFISLVFSAPLLLNALVIVVLWVRKTLVVM TDLRSLREQRRARARPKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF488A conjugate, 0.1mg/mL
BNC881045-500 1x 500 µL

CD16 (C16/1045), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-100 1x 100 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF647 conjugate, 0.1mg/mL
BNC471283-100 1x 100 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL
BNC681198-500 1x 500 µL

Cytokeratin 7 (KRT7/1198), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details