Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NAD (P) transhydrogenase subunit alpha part 2

This Recombinant NAD (P) transhydrogenase subunit alpha part 2 spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

NAD (P) transhydrogenase subunit alpha part 2, EC= 1.6.1.2, Nicotinamide nucleotide transhydrogenase subunit alpha 2, Proton-translocating transhydrogenase component 2, Pyridine nucleotide transhydr

UniProt

P0C187

Expression Region

1-139

Origin

Rhodospirillum rubrum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tstd1 (NM_001164525) AAV Particle
MR214580A1V 250 µL

Mouse Tstd1 (NM_001164525) AAV Particle

Sign In for Pricing
View Details
Lentiviral mouse Hbq1a shRNA (UAS) - Lentiviral mouse Hbq1a shRNA (UAS) (100)
GTR15254298 1 Vial

Lentiviral mouse Hbq1a shRNA (UAS) - Lentiviral mouse Hbq1a shRNA (UAS) (100)

Sign In for Pricing
View Details
ERK1/2 Monoclonal Antibody, Biotin Conjugated
bsm-33234M-Biotin 100 µL

ERK1/2 Monoclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
KLHL20-set siRNA/shRNA/RNAi Lentivector (Human)
25783091 4x 500 ng

KLHL20-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
C8orf76 Antibody - C-terminal region : HRP (ARP69041_P050-HRP)
ARP69041_P050-HRP 100 µL

C8orf76 Antibody - C-terminal region : HRP (ARP69041_P050-HRP)

Sign In for Pricing
View Details
Mouse Immunoglobulin Transcription Factor 2 ELISA Kit
MBS7256158-01 48 Well

Mouse Immunoglobulin Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details