Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NAD (P) transhydrogenase subunit alpha part 2

This Recombinant NAD (P) transhydrogenase subunit alpha part 2 spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

NAD (P) transhydrogenase subunit alpha part 2, EC= 1.6.1.2, Nicotinamide nucleotide transhydrogenase subunit alpha 2, Proton-translocating transhydrogenase component 2, Pyridine nucleotide transhydr

UniProt

P0C187

Expression Region

1-139

Origin

Rhodospirillum rubrum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPOZ Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-12881R-PE-Cy5.5 100 µL

BPOZ Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Dnajb6 (NM_001013209) Rat Tagged ORF Clone Lentiviral Particle
RR208753L4V 200 µL

Dnajb6 (NM_001013209) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MFGE8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1296108 1.0 µg DNA

MFGE8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human CD295 ELISA Kit
CEK1097 96 Tests

Human CD295 ELISA Kit

Sign In for Pricing
View Details
PLA2G4C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV713505 1.0 µg DNA

PLA2G4C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AK1C1 Antibody - C-terminal region (ARP76080_P050)
ARP76080_P050 100 µL

AK1C1 Antibody - C-terminal region (ARP76080_P050)

Sign In for Pricing
View Details