Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NAD (P) transhydrogenase subunit alpha part 2

This Recombinant NAD (P) transhydrogenase subunit alpha part 2 spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

NAD (P) transhydrogenase subunit alpha part 2, EC= 1.6.1.2, Nicotinamide nucleotide transhydrogenase subunit alpha 2, Proton-translocating transhydrogenase component 2, Pyridine nucleotide transhydr

UniProt

P0C187

Expression Region

1-139

Origin

Rhodospirillum rubrum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCP1 Antibody
orb19218 100 µg

UCP1 Antibody

Sign In for Pricing
View Details
Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate
297561-01 500 mg

Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate

Sign In for Pricing
View Details
Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate
297561-02 1 g

Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate

Sign In for Pricing
View Details
Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate
297561-03 2 g

Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate

Sign In for Pricing
View Details
Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate
297561-04 5 g

Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate

Sign In for Pricing
View Details
Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate
297561-05 10 g

Methyl 4-O-[4,6-O- (benzylidene) -b-D-galactopyranosyl] b-D-galactopyranoside tribenzoate

Sign In for Pricing
View Details