Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0716 protein fxsA (fxsA)

This Recombinant UPF0716 protein fxsA (fxsA) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

UPF0716 protein fxsA, Suppressor of F exclusion of phage T7

UniProt

P37148

Expression Region

1-139

Origin

Serratia marcescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWLPLLLIFLLAYIEISIFIKVAAVLGVAVTLLLVVFSSCVGISLVRNQGMKTFVQMQQ KLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPVQKSLTLKLMPHLSVYR PGGWTGGDAANGNTFDGEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]
E-AB-F1144M-01 20 Tests

Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]
E-AB-F1144M-02 100 Tests

Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]
E-AB-F1144M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD49d Antibody[9F10]

Sign In for Pricing
View Details
ROS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]
TA805734BM 100 µL

ROS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details
Phenylglyoxylic Acid
TRC-P327500-2.5G 2.5 g

Phenylglyoxylic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS643983 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details